Values CatLog read from this paper
Modulation of the substrate preference of a MYST acetyltransferase by a scaffold protein
PMID 39909374doi:10.1016/j.jbc.2025.108262Open in Browse
The paper itself is not on this site: read it at the publisher. This page lists only the values CatLog read from it.
CatLog read 40 records (70 values) from this paper: KAT6A MYST domain, KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), KAT6A (full length, KAT6A^FL) and 3 more from Homo sapiens.
Read from the paper by an AI model and checked against the paper by a second, separate AI run; code converted the units. Values are in CatLog's units; each record opens in Browse with the line the paper prints and the checks.
| Enzyme | Organism | Substrate | kcat (s⁻¹) | Km (mM) | kcat/Km (mM⁻¹ s⁻¹) | Conditions | Open record |
|---|---|---|---|---|---|---|---|
| KAT6A (full length, KAT6A^FL) | Homo sapiens | histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA | 0.35 | 0.016 | 24.3 | pH 7.5, 25 °C | Open record: KAT6A (full length, KAT6A^FL), histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA |
| KAT6A (full length, KAT6A^FL) | Homo sapiens | histone H3 residues 10-17 peptide, sequence STGGKAPR | — | — | 0.0098 | pH 7.5, 25 °C | Open record: KAT6A (full length, KAT6A^FL), histone H3 residues 10-17 peptide, sequence STGGKAPR |
| KAT6A (full length, KAT6A^FL) | Homo sapiens | histone H3 residues 19-26 peptide, sequence QLATKAAR | — | — | 2.7 × 10⁻⁴ | pH 7.5, 25 °C | Open record: KAT6A (full length, KAT6A^FL), histone H3 residues 19-26 peptide, sequence QLATKAAR |
| KAT6A (full length, KAT6A^FL) | Homo sapiens | histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP | 0.17 | 0.0032 | 56.2 | pH 7.5, 25 °C | Open record: KAT6A (full length, KAT6A^FL), histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP |
| KAT6A (full length, KAT6A^FL) | Homo sapiens | histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK | 0.0057 | 0.03 | 0.187 | pH 7.5, 25 °C | Open record: KAT6A (full length, KAT6A^FL), histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK |
| KAT6A (full-length, KAT6A^FL) | Homo sapiens | H3 (10-17) chimera P(+2)A, peptide STGGKAAR | — | — | 0.0052 | pH 7.5, 25 °C | Open record: KAT6A (full-length, KAT6A^FL), H3 (10-17) chimera P(+2)A, peptide STGGKAAR |
| KAT6A (full-length, KAT6A^FL) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, peptide QTGGKAAR | — | — | 0.0035 | pH 7.5, 25 °C | Open record: KAT6A (full-length, KAT6A^FL), H3 (10-17) chimera P(+2)A, S(–4)Q, peptide QTGGKAAR |
| KAT6A (full-length, KAT6A^FL) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–1)T, peptide QLGTKAAR | — | — | 2.2 × 10⁻⁴ | pH 7.5, 25 °C | Open record: KAT6A (full-length, KAT6A^FL), H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–1)T, peptide QLGTKAAR |
| KAT6A (full-length, KAT6A^FL) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–2)A, peptide QLAGKAAR | — | — | 4.3 × 10⁻⁴ | pH 7.5, 25 °C | Open record: KAT6A (full-length, KAT6A^FL), H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–2)A, peptide QLAGKAAR |
| KAT6A (full-length, KAT6A^FL) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, peptide QLGGKAAR | — | — | 0.003 | pH 7.5, 25 °C | Open record: KAT6A (full-length, KAT6A^FL), H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, peptide QLGGKAAR |
| KAT6A MYST domain | Homo sapiens | H3 (10-17) chimera P(+2)A, peptide STGGKAAR | — | — | 0.0148 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, H3 (10-17) chimera P(+2)A, peptide STGGKAAR |
| KAT6A MYST domain | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, peptide QTGGKAAR | — | — | 0.0102 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, H3 (10-17) chimera P(+2)A, S(–4)Q, peptide QTGGKAAR |
| KAT6A MYST domain | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–1)T, peptide QLGTKAAR | — | — | 2 × 10⁻⁴ | pH 7.5, 25 °C | Open record: KAT6A MYST domain, H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–1)T, peptide QLGTKAAR |
| KAT6A MYST domain | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–2)A, peptide QLAGKAAR | — | — | 4.5 × 10⁻⁴ | pH 7.5, 25 °C | Open record: KAT6A MYST domain, H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–2)A, peptide QLAGKAAR |
| KAT6A MYST domain | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, peptide QLGGKAAR | — | — | 0.0057 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, peptide QLGGKAAR |
| KAT6A MYST domain | Homo sapiens | histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA | 0.37 | 0.38 | 0.95 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA |
| KAT6A MYST domain | Homo sapiens | histone H3 residues 10-17 peptide, sequence STGGKAPR | — | — | 0.032 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, histone H3 residues 10-17 peptide, sequence STGGKAPR |
| KAT6A MYST domain | Homo sapiens | histone H3 residues 19-26 peptide, sequence QLATKAAR | — | — | 6.8 × 10⁻⁴ | pH 7.5, 25 °C | Open record: KAT6A MYST domain, histone H3 residues 19-26 peptide, sequence QLATKAAR |
| KAT6A MYST domain | Homo sapiens | histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP | 0.163 | 0.13 | 1.32 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP |
| KAT6A MYST domain | Homo sapiens | histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK | 0.005 | 0.36 | 0.0135 | pH 7.5, 25 °C | Open record: KAT6A MYST domain, histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK |
| KAT6A^FL 2-plex (KAT6A-BRPF1 complex) | Homo sapiens | histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA | 0.117 | 0.011 | 10.3 | pH 7.5, 25 °C | Open record: KAT6A^FL 2-plex (KAT6A-BRPF1 complex), histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA |
| KAT6A^FL 2-plex (KAT6A-BRPF1 complex) | Homo sapiens | histone H3 residues 10-17 peptide, sequence STGGKAPR | — | — | 0.0065 | pH 7.5, 25 °C | Open record: KAT6A^FL 2-plex (KAT6A-BRPF1 complex), histone H3 residues 10-17 peptide, sequence STGGKAPR |
| KAT6A^FL 2-plex (KAT6A-BRPF1 complex) | Homo sapiens | histone H3 residues 19-26 peptide, sequence QLATKAAR | — | — | 0.023 | pH 7.5, 25 °C | Open record: KAT6A^FL 2-plex (KAT6A-BRPF1 complex), histone H3 residues 19-26 peptide, sequence QLATKAAR |
| KAT6A^FL 2-plex (KAT6A-BRPF1 complex) | Homo sapiens | histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP | 2.2 | 0.0059 | 363 | pH 7.5, 25 °C | Open record: KAT6A^FL 2-plex (KAT6A-BRPF1 complex), histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP |
| KAT6A^FL 2-plex (KAT6A-BRPF1 complex) | Homo sapiens | histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK | 1.4 | 0.013 | 103.2 | pH 7.5, 25 °C | Open record: KAT6A^FL 2-plex (KAT6A-BRPF1 complex), histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | H3 (10-17) chimera P(+2)A, peptide STGGKAAR | — | — | 0.0047 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), H3 (10-17) chimera P(+2)A, peptide STGGKAAR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, peptide QTGGKAAR | — | — | 0.0023 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), H3 (10-17) chimera P(+2)A, S(–4)Q, peptide QTGGKAAR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–1)T, peptide QLGTKAAR | — | — | 0.0027 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–1)T, peptide QLGTKAAR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–2)A, peptide QLAGKAAR | — | — | 0.001 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, G(–2)A, peptide QLAGKAAR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, peptide QLGGKAAR | — | — | 0.0027 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), H3 (10-17) chimera P(+2)A, S(–4)Q, T(–3)L, peptide QLGGKAAR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA | 0.127 | 0.013 | 9.5 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | histone H3 residues 10-17 peptide, sequence STGGKAPR | — | — | 0.005 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), histone H3 residues 10-17 peptide, sequence STGGKAPR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | histone H3 residues 19-26 peptide, sequence QLATKAAR | — | — | 0.018 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), histone H3 residues 19-26 peptide, sequence QLATKAAR |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP | 1.5 | 0.005 | 303 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP |
| KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex) | Homo sapiens | histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK | 1.48 | 0.016 | 90.3 | pH 7.5, 25 °C | Open record: KAT6A^FL 4-plex (KAT6A-BRPF1-ING5-MEAF6 complex), histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK |
| MYST 2-plex (KAT6A MYST domain-BRPF1 complex) | Homo sapiens | histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA | 0.2 | 0.014 | 15 | pH 7.5, 25 °C | Open record: MYST 2-plex (KAT6A MYST domain-BRPF1 complex), histone H3 residues 1-21 peptide, sequence ARTKQTARKSTGGKAPRKQLA |
| MYST 2-plex (KAT6A MYST domain-BRPF1 complex) | Homo sapiens | histone H3 residues 10-17 peptide, sequence STGGKAPR | — | — | 0.0112 | pH 7.5, 25 °C | Open record: MYST 2-plex (KAT6A MYST domain-BRPF1 complex), histone H3 residues 10-17 peptide, sequence STGGKAPR |
| MYST 2-plex (KAT6A MYST domain-BRPF1 complex) | Homo sapiens | histone H3 residues 19-26 peptide, sequence QLATKAAR | — | — | 0.003 | pH 7.5, 25 °C | Open record: MYST 2-plex (KAT6A MYST domain-BRPF1 complex), histone H3 residues 19-26 peptide, sequence QLATKAAR |
| MYST 2-plex (KAT6A MYST domain-BRPF1 complex) | Homo sapiens | histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP | 0.78 | 0.0015 | 510 | pH 7.5, 25 °C | Open record: MYST 2-plex (KAT6A MYST domain-BRPF1 complex), histone H3.3 residues 1-43 peptide, sequence ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRP |
| MYST 2-plex (KAT6A MYST domain-BRPF1 complex) | Homo sapiens | histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK | 0.47 | 0.036 | 13.7 | pH 7.5, 25 °C | Open record: MYST 2-plex (KAT6A MYST domain-BRPF1 complex), histone H3.3 residues 15-36 peptide, sequence APRKQLATKAARKSAPSTGGVK |